"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P66079"	"{'domain_architectures': 29345, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'pfam': 1, 'pirsf': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 29345}"	"['This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site']"	"rplS"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL19_BRUSU"	"f90fa558b385e8e7a0fbb05d0f0ba2d14ab5a791"	True	False	False	145	"Large ribosomal subunit protein bL19"	3	"UP000007104"	"MTDIIRQLEAEQAAKIEEKRKLPDFQPGDTVRVQVRVTEGTRTRVQAYEGVCIARSGAGLNENFTVRKISYGEGVERVFPVYSPIVEGVEVVRRGKVRRAKLYYLRGLTGKAARIAEKKDNRTKAERAADKLAAAKAEAAKTAAE"	"reviewed"	"{'taxId': '204722', 'scientificName': 'Brucella suis biovar 1 (strain 1330)', 'fullName': 'Brucella suis biovar 1 (strain 1330)'}"