General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P62650",
        "id": "RL22_NANEQ",
        "source_organism": {
            "taxId": "228908",
            "scientificName": "Nanoarchaeum equitans (strain Kin4-M)",
            "fullName": "Nanoarchaeum equitans (strain Kin4-M)"
        },
        "name": "Large ribosomal subunit protein uL22",
        "description": [
            "This protein binds specifically to 23S rRNA. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome",
            "The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome"
        ],
        "length": 174,
        "sequence": "MRYSVSLENVAKLYAHNLPISTKHAVEIAKMIRYLPLQLAKEMLQKVLDKELAVPFFRYNRDIPHRKKGQIHPYFKIKHGRFPENATKWILKELNSVEKNAINLGMDPNKLFIVHIAAHKGVRGYTSVYGRRARRKATHLEIMVAENKDYDPSKKYPLKELKRMGHKLFLSLKK",
        "proteome": "UP000000578",
        "gene": "rpl22",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0015934",
                "name": "large ribosomal subunit",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "c33fece06d00a2e6902b8b7efbe7e3e414e72fb4",
        "counters": {
            "domain_architectures": 29382,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29382
        }
    }
}