"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P61611"	"{'domain_architectures': 20379, 'entries': 20, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cathgene3d': 2, 'ssf': 2, 'cdd': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'prints': 1, 'interpro': 9}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 20379}"	"['Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair']"	"lexA"	"[{'identifier': 'GO:0004252', 'name': 'serine-type endopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006508', 'name': 'proteolysis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009432', 'name': 'SOS response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045892', 'name': 'negative regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"LEXA_LEPIC"	"80ebd7e7a187ff1e5bf9b0d007a9803b2e453c54"	True	False	False	203	"LexA repressor"	3	""	"MKDLTDKQQAVLAFITAIIKERGFPPTIREIGDEFGITAKGAYDHLKAIEKKGYLKTAKNQSRAIELIRQSPMESLPVQATSIPVIGQVAAGLPIFAEENIESYIPVPDEMAKGNVPMYALRVQGDSMIEVGINDGDIAIIEKRDIARNGEIVVALIEDEATLKVYYKEQDQIRLEARNPKYKPIKTKKATVMGKLIGLYRIY"	"reviewed"	"{'taxId': '267671', 'scientificName': 'Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)', 'fullName': 'Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)'}"
