General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P61578",
        "id": "REC16_HUMAN",
        "source_organism": {
            "taxId": "9606",
            "scientificName": "Homo sapiens",
            "fullName": "Homo sapiens (Human)"
        },
        "name": "Endogenous retrovirus group K member 16 Rec protein",
        "description": [
            "Retroviral replication requires the nuclear export and translation of unspliced, singly-spliced and multiply-spliced derivatives of the initial genomic transcript. Rec interacts with a highly structured RNA element (RcRE) present in the viral 3'LTR and recruits the cellular nuclear export machinery. This permits export to the cytoplasm of unspliced genomic or incompletely spliced subgenomic viral transcripts (By similarity)"
        ],
        "length": 105,
        "sequence": "MNPSEMQRKAPPRRRRHRNRAPSSHKMNKMMMSEEQMKLPSTNKAEPLTWAQLNKLTQLATKCLENTKMTQTPESMLLAALMIVSTVSAGVPNSSEETVTIENGP",
        "proteome": "UP000005640",
        "gene": "ERVK-16",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "31cd0e662c05342500c251495bc7832e8a3ecd55",
        "counters": {
            "domain_architectures": 72,
            "entries": 2,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 72
        }
    }
}