"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P59637"	"{'domain_architectures': 981, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 5, 'taxa': 1, 'dbEntries': {'profile': 1, 'cdd': 1, 'cathgene3d': 1, 'hamap': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 981}"	"['Plays a central role in virus morphogenesis and assembly. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis (By similarity). Activates the host NLRP3 inflammasome, leading to IL-1beta overproduction']"	"E"	"[{'identifier': 'GO:0019068', 'name': 'virion assembly', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0046760', 'name': 'viral budding from Golgi membrane', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"VEMP_SARS"	"fe089b24b8342db75b5f45561e57c179de583659"	False	False	False	76	"Envelope small membrane protein"	1	"UP000000354"	"MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV"	"reviewed"	"{'taxId': '694009', 'scientificName': 'Severe acute respiratory syndrome coronavirus', 'fullName': 'Severe acute respiratory syndrome coronavirus (SARS-CoV)'}"