GET /api/protein/UniProt/P55858/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P55858",
        "id": "RL7A_SACS2",
        "source_organism": {
            "taxId": "273057",
            "scientificName": "Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)",
            "fullName": "Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)"
        },
        "name": "Large ribosomal subunit protein eL8",
        "description": [
            "Multifunctional RNA-binding protein that recognizes the K-turn motif in ribosomal RNA, the RNA component of RNase P, box H/ACA, box C/D (PubMed:19666563) and box C'/D' sRNAs",
            "Component of the small ribosomal subunit (PubMed:39753558). The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell (PubMed:39753558). Binds 16S (small) rRNA (PubMed:39753558)"
        ],
        "length": 127,
        "sequence": "MSKASYVKFEVPQDLADKVLEAVRKAKESGKIKKGTNETTKAVERGQAKLVIIAEDVQPEEIVAHLPLLCDEKKIPYVYVSSKKALGEACGLQVATASAAILEPGEAKDLVDEIIKRVNEIKGKTSS",
        "proteome": "UP000001974",
        "gene": "rpl7ae",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0042254",
                "name": "ribosome biogenesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:1990904",
                "name": "ribonucleoprotein complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "e648c895252343045e836caf4ce7bf2296aeba99",
        "counters": {
            "domain_architectures": 37350,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 13,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37350
        }
    }
}