GET /api/protein/UniProt/P54520/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P54520",
"id": "NUSB_BACSU",
"source_organism": {
"taxId": "224308",
"scientificName": "Bacillus subtilis (strain 168)",
"fullName": "Bacillus subtilis (strain 168)"
},
"name": "Transcription antitermination protein NusB",
"description": [
"Involved in transcription antitermination. Required for transcription of ribosomal RNA (rRNA) genes. Binds specifically to the boxA antiterminator sequence of the ribosomal RNA (rrn) operons"
],
"length": 131,
"sequence": "MKRRTAREKALQALFQIDVSDIAVNEAIEHALDEEKTDPFFEQLVHGVLEHQDQLDEMISKHLVNWKLDRIANVDRAILRLAAYEMAYAEDIPVNVSMNEAIELAKRFGDDKATKFVNGVLSNIKSDIEQS",
"proteome": "UP000001570",
"gene": "nusB",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006353",
"name": "DNA-templated transcription termination",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cc388573da50339aac79362317b07a3762362074",
"counters": {
"domain_architectures": 25665,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25665
}
}
}