"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P50637"	"{'domain_architectures': 14998, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 2, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'panther': 1, 'pfam': 1, 'pirsf': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 14998}"	"['Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme (By similarity). Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides. Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism (PubMed:9832438, PubMed:24814875), but its precise physiological role is controversial. According to some reports, it is not required for steroid hormone biosynthesis (PubMed:24174323, PubMed:24936060)']"	"Tspo"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"TSPO_MOUSE"	"f226b116a04845541d32ffad7e61a9d98cd7a3c0"	True	False	False	169	"Translocator protein"	1	"UP000000589"	"MPESWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAMGYGSYIVWKELGGFTEDAMVPLGLYTGQLALNWAWPPIFFGARQMGWALADLLLVSGVATATTLAWHRVSPPAARLLYPYLAWLAFATVLNYYVWRDNSGRRGGSRLPE"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"