"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P49987"	"{'domain_architectures': 19842, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 19842}"	"['Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage (By similarity)']"	"recA"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0140664', 'name': 'ATP-dependent DNA damage sensor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006281', 'name': 'DNA repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003697', 'name': 'single-stranded DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RECA_STRSL"	"587eece09887d594749c5f5591ff82b2a75372d1"	True	False	True	104	"Protein RecA"	3	""	"AYARALGVNIDELLLSQPDSGEQGLEIAGKLIDSGAVDLVVVDSVAAFVPRAEIDGDSGDSHVGLQARMMSQAMRKLSASINKTKTIAIFINQLREKVGIMFGN"	"reviewed"	"{'taxId': '1304', 'scientificName': 'Streptococcus salivarius', 'fullName': 'Streptococcus salivarius'}"