GET /api/protein/UniProt/P48739/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P48739",
        "id": "PIPNB_HUMAN",
        "source_organism": {
            "taxId": "9606",
            "scientificName": "Homo sapiens",
            "fullName": "Homo sapiens (Human)"
        },
        "name": "Phosphatidylinositol transfer protein beta isoform",
        "description": [
            "Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes (PubMed:10531358, PubMed:18636990, PubMed:20332109). Also catalyzes the transfer of sphingomyelin (By similarity). Required for COPI-mediated retrograde transport from the Golgi to the endoplasmic reticulum; phosphatidylinositol and phosphatidylcholine transfer activity is essential for this function (PubMed:20332109)"
        ],
        "length": 271,
        "sequence": "MVLIKEFRVVLPCSVQEYQVGQLYSVAEASKNETGGGEGIEVLKNEPYEKDGEKGQYTHKIYHLKSKVPAFVRMIAPEGSLVFHEKAWNAYPYCRTIVTNEYMKDDFFIKIETWHKPDLGTLENVHGLDPNTWKTVEIVHIDIADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYKLVTIKFKWWGLQSKVENFIQKQEKRIFTNFHRQLFCWIDKWIDLTMEDIRRMEDETQKELETMRKRGSVRGTSAADV",
        "proteome": "UP000005640",
        "gene": "PITPNB",
        "go_terms": [
            {
                "identifier": "GO:0005548",
                "name": "phospholipid transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015914",
                "name": "phospholipid transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "072a68c18bab7d68550f284a57e75563cf8f21e3",
        "counters": {
            "domain_architectures": 8227,
            "entries": 9,
            "isoforms": 3,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8227
        }
    }
}