General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 110.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P48272",
        "id": "PSBY_CYAPA",
        "source_organism": {
            "taxId": "2762",
            "scientificName": "Cyanophora paradoxa",
            "fullName": "Cyanophora paradoxa"
        },
        "name": "Photosystem II reaction center protein Y",
        "description": [
            "Loosely associated component of the core of photosystem II (PSII), it is not always seen in crystals. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation"
        ],
        "length": 38,
        "sequence": "MSMRLVVVLLPLGIALGWAVYNIGKLAIEQWRRTGSKV",
        "proteome": null,
        "gene": "psbY",
        "go_terms": [
            {
                "identifier": "GO:0030145",
                "name": "manganese ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015979",
                "name": "photosynthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009523",
                "name": "photosystem II",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "4e166260351c81a4a389ea29c2915799427d111a",
        "counters": {
            "domain_architectures": 348,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 348
        }
    }
}