General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P47648",
        "id": "MSRA_MYCGE",
        "source_organism": {
            "taxId": "243273",
            "scientificName": "Mycoplasmoides genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)",
            "fullName": "Mycoplasmoides genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)"
        },
        "name": "Peptide methionine sulfoxide reductase MsrA",
        "description": [
            "Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity)"
        ],
        "length": 157,
        "sequence": "MKEIYFGGGCFWGIEKYFQLIKGVKKTSVGYLNSRIRNPSYEQVCSGYTNAVEAVKVEYEEKEISLSELIEALFEVIDPTIRNRQGNDIGTQYRTGIYWTDSSDEKIINDKFLKLQKNYSKPIVTENKKVENYYLAEEYHQDYLKKNPNGYCHIKFD",
        "proteome": "UP000000807",
        "gene": "msrA",
        "go_terms": [
            {
                "identifier": "GO:0008113",
                "name": "peptide-methionine (S)-S-oxide reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "47a64c36b2d13edfc0db84d999e2ce356181eb1f",
        "counters": {
            "domain_architectures": 29826,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 29826
        }
    }
}