"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P43724"	"{'domain_architectures': 61377, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'pfam': 1, 'smart': 1, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'ncbifam': 2, 'hamap': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 61377}"	"['This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control']"	"ihfB"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0030527', 'name': 'structural constituent of chromatin', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006310', 'name': 'DNA recombination', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005694', 'name': 'chromosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"IHFB_HAEIN"	"69cfcabeafc3186618e3c95978399e9c6cf3360d"	True	False	False	94	"Integration host factor subunit beta"	3	"UP000000579"	"MTKSELMEKLSAKQPTLPAKEIENMVKGILEFISQSLENGDRVEVRGFGSFSLHHRQPRLGRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA"	"reviewed"	"{'taxId': '71421', 'scientificName': 'Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)', 'fullName': 'Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)'}"