"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P41272"	"{'domain_architectures': 0, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'smart': 1, 'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1}"	"['Costimulatory immune-checkpoint receptor expressed at the surface of T-cells, NK-cells and B-cells which binds to and is activated by its ligand CD70/CD27L expressed by B-cells. The CD70-CD27 signaling pathway mediates antigen-specific T-cell activation and expansion which in turn provides immune surveillance of B-cells (PubMed:11062504). Mechanistically, CD70 ligation activates the TRAF2-PTPN6 axis that subsequently inhibits LCK phosphorylation to promote phenotypic and transcriptional adaptations of T-cell memory (By similarity). In addition, activation by CD70 on early progenitor cells provides a negative feedback signal to leukocyte differentiation during immune activation and thus modulates hematopoiesis (PubMed:15723067). Negatively regulates the function of Th2 lymphocytes in the adipose tissue (PubMed:38386557)']"	"Cd27"	"[{'identifier': 'GO:0045579', 'name': 'positive regulation of B cell differentiation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045582', 'name': 'positive regulation of T cell differentiation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004888', 'name': 'transmembrane signaling receptor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0043066', 'name': 'negative regulation of apoptotic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"CD27_MOUSE"	""	True	False	False	250	"CD27 antigen"	2	"UP000000589"	"MAWPPPYWLCMLGTLVGLSATLAPNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP"	"reviewed"	"{'taxId': '10090', 'scientificName': 'Mus musculus', 'fullName': 'Mus musculus (Mouse)'}"