"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P40946"	"{'domain_architectures': 72767, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 3, 'pfam': 1, 'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'ssf': 1, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 72767}"	"['GTP-binding protein involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus (By similarity). Promotes cell movement and remodeling of the actin cytoskeleton during compound eye morphogenesis (PubMed:21976699). Required for normal ethanol-induced tolerance and preference (PubMed:28607459). Probably after Efa6-mediated activation, counteracts ethanol-induced sedation (PubMed:28607459)']"	"Arf6"	"[{'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"ARF6_DROME"	"d6bc1331c4b416e231f52943c4822a3a2b702855"	True	False	False	175	"ADP-ribosylation factor 6"	1	"UP000000803"	"MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLSEGLIWLTSNHKL"	"reviewed"	"{'taxId': '7227', 'scientificName': 'Drosophila melanogaster', 'fullName': 'Drosophila melanogaster (Fruit fly)'}"