"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P37305"	"{'domain_architectures': 3175, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ncbifam': 1, 'pfam': 1, 'prosite': 1, 'prints': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3175}"	"['Toxic component of a type I toxin-antitoxin (TA) system (Probable). When overexpressed kills cells within minutes; causes collapse of the transmembrane potential and arrest of respiration (PubMed:10361310, PubMed:20105222). Its toxic effect is probably neutralized by antisense antitoxin RNA SokA (PubMed:10361310)']"	"hokA"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"HOKA_ECOLI"	"eb4d0f1f9addd9eb22286ce85a6d3855766e7b5c"	True	False	False	50	"Protein HokA"	1	"UP000000625"	"MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE"	"reviewed"	"{'taxId': '83333', 'scientificName': 'Escherichia coli (strain K12)', 'fullName': 'Escherichia coli (strain K12)'}"