"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P16341"	"{'domain_architectures': 254, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 1, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 254}"	"['Blocker for the small conductance calcium-activated potassium channels (PubMed:11527975, PubMed:2307683, PubMed:2839478). Shows the best affinity for KCa2.2/KCNN2 (Kd=0.2 nM), followed by KCa2.3/KCNN3 (Kd=1.1 nM) and KCa2.1/KCNN1 (Kd=325 nM) (PubMed:11527975)']"	""	"[{'identifier': 'GO:0008200', 'name': 'ion channel inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"KAX51_LEIHE"	"edc53731ca9e1538837bf0c0212e1bbba7568ac8"	True	False	False	31	"Potassium channel toxin alpha-KTx 5.1"	1	""	"AFCNLRMCQLSCRSLGLLGKCIGDKCECVKH"	"reviewed"	"{'taxId': '2899558', 'scientificName': 'Leiurus hebraeus', 'fullName': 'Leiurus hebraeus (Hebrew deathstalker scorpion)'}"