General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P13854",
        "id": "MGF_CHICK",
        "source_organism": {
            "taxId": "9031",
            "scientificName": "Gallus gallus",
            "fullName": "Gallus gallus (Chicken)"
        },
        "name": "Myelomonocytic growth factor",
        "description": [
            "Hematopoietic growth factor that stimulates the proliferation and colony formation of normal and transformed avian cells of the myeloid lineage"
        ],
        "length": 201,
        "sequence": "MCCLTPVLALALVLGAPWQALHGAPLAELSGDHDFQLFLHKNLEFTRKIRGDVAALQRAVCDTFQLCTEEELQLVQPDPHLVQAPLDQCHKRGFQAEVCFTQIRAGLHAYHDSLGAVLRLLPNHTTLVETLQLDAANLSSNIQQQMEDLGLDTVTLPAEQRSPPPTFSGPFQQQVGGFFILANFQRFLETAYRALRHLARL",
        "proteome": "UP000000539",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005125",
                "name": "cytokine activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0045639",
                "name": "positive regulation of myeloid cell differentiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "dd6031ddee8b22da3a3ddf9ce1e1c615dd71d4a5",
        "counters": {
            "domain_architectures": 626,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "prosite": 1,
                "prints": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 626
        }
    }
}