General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P12376",
        "id": "COPC_PSEUB",
        "source_organism": {
            "taxId": "323",
            "scientificName": "Pseudomonas syringae pv. tomato",
            "fullName": "Pseudomonas syringae pv. tomato"
        },
        "name": "Copper resistance protein C",
        "description": [
            "Copper-binding protein involved in copper resistance and homeostasis (PubMed:12377120, PubMed:16022515, PubMed:16637653, PubMed:1924351, PubMed:3372485). Probably mediates copper resistance by sequestering the excess of copper in the periplasm (PubMed:1924351). May act as a copper carrier in the oxidizing periplasmic space that exchanges either Cu(I) or Cu(II) with its putative partners CopA, CopB and CopD (PubMed:16022515, PubMed:16637653)"
        ],
        "length": 126,
        "sequence": "MLLNRTSFVTLFAAGMLVSALAQAHPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK",
        "proteome": null,
        "gene": "copC",
        "go_terms": [
            {
                "identifier": "GO:0005507",
                "name": "copper ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046688",
                "name": "response to copper ion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042597",
                "name": "periplasmic space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0006825",
                "name": "copper ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "8f0e786549380370a36c973cabfc3b0c29845d44",
        "counters": {
            "domain_architectures": 7806,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 3,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7806
        }
    }
}