"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P12327"	"{'domain_architectures': 20743, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 20743}"	"['The light-harvesting complex (LHC) functions as a light receptor, it captures and delivers excitation energy to photosystems with which it is closely associated']"	""	"[{'identifier': 'GO:0009765', 'name': 'photosynthesis, light harvesting', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"CB21_EUGGR"	"c3c39b492cec2880b905b58a2a6af891ce705de4"	True	False	True	127	"Chlorophyll a-b binding protein of LHCII type 1"	2	""	"VVQALIHAKSLLAILATQVLLMGAVEGYRAGNTAPGQFGEDLDRLYPGGPFDPLGLADDPDTFPELKVKEIKNGRLAMSGMLGFYAQAIVTGEGPVENWLYHLQDPSAHNGLTALVTQFAPTPVALL"	"reviewed"	"{'taxId': '3039', 'scientificName': 'Euglena gracilis', 'fullName': 'Euglena gracilis'}"