"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0CY10"	"{'domain_architectures': 145457, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 4, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'smart': 1, 'cdd': 1, 'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 145457}"	"['Mating type proteins are sequence specific DNA-binding proteins that act as master switches in yeast differentiation by controlling gene expression in a cell type-specific fashion. Transcriptional corepressor that, in a/alpha diploid cells, binds cooperatively with the ALPHA2 protein to a 21-bp DNA sequence termed the haploid-specific gene (hsg) operator, to repress transcription of haploid-specific genes and of MATALPHA1']"	"MATA1"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000981', 'name': 'DNA-binding transcription factor activity, RNA polymerase II-specific', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"MATA1_YEASX"	"1cca9db9652b5e6e0313f2eed7be72cec278d12f"	True	False	False	126	"Mating-type protein A1"	1	""	"MDDICSMAENINRTLFNILGTEIDEINLNTNNLYNFIMESNLTKVEQHTLHKNISNNRLEIYHHIKKEKSPKGKSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK"	"reviewed"	"{'taxId': '4932', 'scientificName': 'Saccharomyces cerevisiae', 'fullName': ""Saccharomyces cerevisiae (Baker's yeast)""}"