General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0C258",
        "id": "I2B2_CONSR",
        "source_organism": {
            "taxId": "101315",
            "scientificName": "Conus striolatus",
            "fullName": "Conus striolatus (Cone snail)"
        },
        "name": "Kappa-conotoxin-like Sx11.2",
        "description": [
            "Modulator of potassium channels, specifically up-modulates the calcium and voltage-gated BK channels, has no effect on single channel conductance, but increases the open probability of BK channels"
        ],
        "length": 70,
        "sequence": "MMFRVTSVGCLLLVIVFLNLVVPTSACRAEGTYCENDSQCCLNECCWGGCGHPCRHPGKRSKLQEFFRQR",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "bdede0b0c852a9a1674aa430a745b92d5a33b306",
        "counters": {
            "domain_architectures": 153,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 153
        }
    }
}