"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0ABS8"	"{'domain_architectures': 1814, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 5, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1814}"	"[""DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity"", 'The exact function of the theta subunit is unknown']"	"holE"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003887', 'name': 'DNA-directed DNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006260', 'name': 'DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"HOLE_ECOLI"	"ec461ba33a8f2c651f66aaa9af2ef1b6d34acdea"	True	False	False	76	"DNA polymerase III subunit theta"	1	"UP000000625"	"MLKNLAKLDQTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLPYEPKLK"	"reviewed"	"{'taxId': '83333', 'scientificName': 'Escherichia coli (strain K12)', 'fullName': 'Escherichia coli (strain K12)'}"