"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P01936"	"{'domain_architectures': 26315, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prints': 2, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26315}"	"['Involved in oxygen transport from the lung to the various peripheral tissues', 'Hemopressin acts as an antagonist peptide of the cannabinoid receptor CNR1. Hemopressin-binding efficiently blocks cannabinoid receptor CNR1 and subsequent signaling']"	"HBA"	"[{'identifier': 'GO:0020037', 'name': 'heme binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019825', 'name': 'oxygen binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015671', 'name': 'oxygen transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005833', 'name': 'hemoglobin complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"HBA_EULFU"	"479f10f36c30dd70c041c861502b6b89292a259d"	True	False	False	141	"Hemoglobin subunit alpha"	1	""	"VLSPADKTNVKTAWNAVGGQAGEHGAEALERMFLSFPTTKTYFPHFDLSHGSGQVKAHGKKVADALTNAVSHLDDMPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPAEFTPAVHASLDKFFAAVSTVLTSKYR"	"reviewed"	"{'taxId': '40322', 'scientificName': 'Eulemur fulvus fulvus', 'fullName': 'Eulemur fulvus fulvus (Brown lemur)'}"