GET /api/protein/UniProt/P01040/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P01040",
"id": "CYTA_HUMAN",
"source_organism": {
"taxId": "9606",
"scientificName": "Homo sapiens",
"fullName": "Homo sapiens (Human)"
},
"name": "Cystatin-A",
"description": [
"This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis"
],
"length": 98,
"sequence": "MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF",
"proteome": "UP000005640",
"gene": "CSTA",
"go_terms": [
{
"identifier": "GO:0004869",
"name": "cysteine-type endopeptidase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004866",
"name": "endopeptidase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d7124d54d2e57a8e462acfc54e3c06df2ea178fc",
"counters": {
"domain_architectures": 11445,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 14,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11445
}
}
}