General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P01040",
        "id": "CYTA_HUMAN",
        "source_organism": {
            "taxId": "9606",
            "scientificName": "Homo sapiens",
            "fullName": "Homo sapiens (Human)"
        },
        "name": "Cystatin-A",
        "description": [
            "This is an intracellular thiol proteinase inhibitor. Has an important role in desmosome-mediated cell-cell adhesion in the lower levels of the epidermis"
        ],
        "length": 98,
        "sequence": "MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF",
        "proteome": "UP000005640",
        "gene": "CSTA",
        "go_terms": [
            {
                "identifier": "GO:0004869",
                "name": "cysteine-type endopeptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004866",
                "name": "endopeptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d7124d54d2e57a8e462acfc54e3c06df2ea178fc",
        "counters": {
            "domain_architectures": 11445,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 14,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11445
        }
    }
}