"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"N9J832"	"{'domain_architectures': 11937, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'pirsf': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 11937}"	"['Involved in the hydrocarbon hydroxylating system, which transfers electrons from NADH to rubredoxin reductase and then through rubredoxin to alkane 1 monooxygenase']"	"F913_03209"	"[{'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"N9J832_ACIBA"	"6e4e309bcfe616c94578c6d62671214fe675b363"	True	False	False	54	"Rubredoxin"	3	""	"MKKYQCIVCGWIYDEAEGWPQDGIAAGTKWEDIPDDWTCPDCGVSKADFEMIEI"	"unreviewed"	"{'taxId': '1217629', 'scientificName': 'Acinetobacter baumannii NIPH 80', 'fullName': 'Acinetobacter baumannii NIPH 80'}"