"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"N8Q9E3"	"{'domain_architectures': 48983, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 48983}"	"['Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome']"	"rplN"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015934', 'name': 'large ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"N8Q9E3_9GAMM"	"bfe0eecd917e299541388c0abf6635e43a3ce085"	True	False	False	122	"Large ribosomal subunit protein uL14"	3	"UP000023776"	"MIQTESMLDVADNSGARRVQCIKVLGGSHRRYASVGDIIKVTVKEAIPRARVKKGDVMNAVVVRTKFGIRRPDGSVIRFDDNAAVILNNNKAPIATRIFGPVTRELRTEQFMKIISLAPEVL"	"unreviewed"	"{'taxId': '981333', 'scientificName': 'Acinetobacter parvus DSM 16617 = CIP 108168', 'fullName': 'Acinetobacter parvus DSM 16617 = CIP 108168'}"
