"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M9U6S9"	"{'domain_architectures': 9806, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'panther': 1, 'pirsf': 1, 'ncbifam': 1, 'hamap': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9806}"	"['DNA-dependent RNA polymerase (RNAP) catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. This subunit is less well bound than the others']"	"rpo4"	"[{'identifier': 'GO:0000166', 'name': 'nucleotide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006352', 'name': 'DNA-templated transcription initiation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030880', 'name': 'RNA polymerase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"M9U6S9_SACIS"	"00ff8f23a337786e25d53a90c9e5a62021b5c458"	True	False	False	113	"DNA-directed RNA polymerase subunit Rpo4"	3	""	"MSSVYIVEEHYIPYSVAKKLLSDVIKSGSSSNLLQRTYDYLNSVEKCDAESAQKVVEELSSIISREDVRAVLASICPITLDEVRSILIMDSNRTYTSEDIQKIIDIIRKYIKS"	"unreviewed"	"{'taxId': '1241935', 'scientificName': 'Saccharolobus islandicus LAL14/1', 'fullName': 'Saccharolobus islandicus LAL14/1'}"