"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M9NW09"	"{'domain_architectures': 65483, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 65483}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I']"	"ND3"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"M9NW09_9HYST"	"e9a5b42e32de65bd6bc464b4186c01128f5abeb7"	True	False	False	115	"NADH-ubiquinone oxidoreductase chain 3"	3	""	"MNMMVSIFTNYFLTSILVTVAFWLPQLNTYTEKISPYECGFDPVESARLPFSMKFFLIAITFLLFDLEIALLLPLPWAIQTNNLKSMITVALMLILILALGLAYEWMQKGLEWTE"	"unreviewed"	"{'taxId': '190504', 'scientificName': 'Coendou insidiosus', 'fullName': 'Coendou insidiosus'}"
