"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M7RS29"	"{'domain_architectures': 37286, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 2, 'cdd': 1, 'ncbifam': 1, 'pirsf': 1, 'panther': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 37286}"	"['Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides']"	"A670_00194"	"[{'identifier': 'GO:0016209', 'name': 'antioxidant activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051920', 'name': 'peroxiredoxin activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"M7RS29_SALDU"	"9db26b9b236ea914ef8a2d52a7760b3ae17fb31b"	True	False	False	200	"Alkyl hydroperoxide reductase protein C22"	3	""	"MVLVTRQAPDFTAAAVLGSGEIVDKFNFKQHTNGKTTVLFFWPMDFTFVCPSELIAFDKRYEEFQKRGVEVVGVSFDSEFVHNAWRNTPVDKGGIGPVKYAMVADVKREIQKAYGIEHPDEGVALRGSFLIDANGIVRHQVVNDLPLGRNIDEMLRMVDALQFHEEHGDVCPAQWEKGKEGMNASPDGVAKYLAENISSL"	"unreviewed"	"{'taxId': '1192688', 'scientificName': 'Salmonella enterica subsp. enterica serovar Dublin str. UC16', 'fullName': 'Salmonella enterica subsp. enterica serovar Dublin str. UC16'}"
