"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M7BBB7"	"{'domain_architectures': 6728, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'prints': 2, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6728}"	"['Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver']"	"UY3_10024"	"[{'identifier': 'GO:0005179', 'name': 'hormone activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"M7BBB7_CHEMY"	"b9ca085d0992375b116a007d7162409be3587261"	True	False	False	107	"Insulin"	3	"UP000031443"	"MALWIQSLPLLALLALSGLTISHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDLEQPLANGHLQNAVEELPFQQQEYQQEKRGIVEQCCHSTCSLYQLENYCN"	"unreviewed"	"{'taxId': '8469', 'scientificName': 'Chelonia mydas', 'fullName': 'Chelonia mydas (Green sea-turtle)'}"