"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M2XEM3"	"{'domain_architectures': 50002, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'pirsf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 50002}"	"['Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA']"	"rpsS"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015935', 'name': 'small ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"M2XEM3_9NOCA"	"8102f30e9f63f37ede7882f240b268854d5a4596"	True	False	False	93	"Small ribosomal subunit protein uS19"	3	"UP000011731"	"MPRSLKKGPFVDDHLLAKVDTQNEKGTKQVIKTWSRRSTILPDFIGHTFAVHDGRKHVPVFVSESMVGHKLGEFAPTRTFKGHIKDDRKSKRR"	"unreviewed"	"{'taxId': '1278076', 'scientificName': 'Rhodococcus ruber BKS 20-38', 'fullName': 'Rhodococcus ruber BKS 20-38'}"
