"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M1VMM6"	"{'domain_architectures': 70645, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'smart': 1, 'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 70645}"	"['Probably involved with other LSm subunits in the general process of degradation of mRNAs']"	"LSM1"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000956', 'name': 'nuclear-transcribed mRNA catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"M1VMM6_CYAM1"	"83b18cf71a575d59c0de6840812ffe7912383fc4"	True	False	False	124	"U6 snRNA-associated Sm-like protein LSm1"	3	"UP000007014"	"MSDALVDDLDKRVLVYLRDGRFFLGYLRSFDQYGNLTLEDATERVVVNDEAFADIPRGLQVFRGENVVLFGAVDSEQRELEFLRKLRRVTEEEIRRMEQAVAEDHAALRRRERLEWPAFDDGAL"	"unreviewed"	"{'taxId': '280699', 'scientificName': 'Cyanidioschyzon merolae (strain NIES-3377 / 10D)', 'fullName': 'Cyanidioschyzon merolae (strain NIES-3377 / 10D) (Unicellular red alga)'}"
