"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"M0QVI7"	"{'domain_architectures': 212, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 212}"	"['Binds and retains class I heavy chains in the endoplasmic reticulum during the early period of virus infection, thereby impairing their transport to the cell surface. Also delays the expression of class I alleles that it cannot affect by direct retention. Binds transporters associated with antigen processing (TAP) and acts as a tapasin inhibitor, preventing class I/TAP association. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes']"	"E3"	"[{'identifier': 'GO:0005537', 'name': 'D-mannose binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0052031', 'name': 'symbiont-mediated perturbation of host defense response', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"M0QVI7_9ADEN"	"c09a65c6fe180942917741a571d8d65402d8e8f0"	False	False	False	156	"Early E3 18.5 kDa glycoprotein"	3	""	"MKGLLLIILSLVGGVLSCHEQPRCNITTGNERSECSVVIKCEHKCSLNITFKNKTMGNVWVGFWQPGDEQNYTVTVHGSDGNHTFGFKFIFEVMCDITLHVARLHGLWPPTKENMVGFSLAFVIMACLMSGLLVGALVWFLKRKPRYGNEEKEKLL"	"unreviewed"	"{'taxId': '46938', 'scientificName': 'Human adenovirus 43', 'fullName': 'Human adenovirus 43'}"
