"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L8H4S3"	"{'domain_architectures': 222038, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 222038}"	"['As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs']"	"ACA1_098970"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"L8H4S3_ACACF"	"0eb7dadcabd2c02a94f505008bf374cf6371f960"	True	False	False	146	"RNA-binding protein 48"	3	"UP000011083"	"MEKHVRGQEESGSREAYRRGKSPKAVKAFSIVKESRHVLVQNVPAVGVQEDLLALFSAHGHVEECRAIGEEELPREQFTEVYLITFAQLSDARRAKRKCDDHNFMGAILHVTYAPEFETLEDTRRKLEQRRTEVLTRVQGTVAALA"	"unreviewed"	"{'taxId': '1257118', 'scientificName': 'Acanthamoeba castellanii (strain ATCC 30010 / Neff)', 'fullName': 'Acanthamoeba castellanii (strain ATCC 30010 / Neff)'}"
