"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L5LPB7"	"{'domain_architectures': 5563, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'smart': 1, 'panther': 1, 'pirsf': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5563}"	"['Possible candidate as a tumor suppressor gene of neuroblastoma. May play an important role in preventing cells from entering the final stage (G1/S) of the transformation process']"	"MDA_GLEAN10024275"	""	"L5LPB7_MYODS"	"a1706f3a392a3e87273a6981f3ecd6b51d020763"	True	False	False	181	"Neuroblastoma suppressor of tumorigenicity 1"	3	"UP000010556"	"MMLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSPPGTHPHPHPHLHPGGQTPEPEEPPGAPHTEEEGAED"	"unreviewed"	"{'taxId': '225400', 'scientificName': 'Myotis davidii', 'fullName': ""Myotis davidii (David's myotis)""}"