"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L5JPX3"	"{'domain_architectures': 3473, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'pfam': 2, 'panther': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 3473}"	"['Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition']"	"PAL_GLEAN10019499"	"[{'identifier': 'GO:0008537', 'name': 'proteasome activator complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"L5JPX3_PTEAL"	"10e2f3fb4bf16e242b53ca9f6ffe5ab601de5694"	True	False	False	254	"Proteasome activator complex subunit 3"	3	"UP000010552"	"MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY"	"unreviewed"	"{'taxId': '9402', 'scientificName': 'Pteropus alecto', 'fullName': 'Pteropus alecto (Black flying fox)'}"