"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L0CKS3"	"{'domain_architectures': 18780, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 18780}"	"['Central component in molecular interactions underlying sperm crawling. Forms an extensive filament system that extends from sperm villipoda, along the leading edge of the pseudopod']"	"MSP"	""	"L0CKS3_OESDE"	"15912120c884367a05ea3e431a6fdf0c2c4e326a"	True	False	False	126	"Major sperm protein"	4	""	"MATVPPGDIHTQPGSKIVFNAPYDDKHTYHIKITNASGRRIGWAIKTTNMRRHGVDPACGVLDPKETTLMAVSCDTFDYGREDTNNDRITVEWCNTPEGAAKQFRREWFQGDGMVRRKNLPIEYNL"	"unreviewed"	"{'taxId': '61180', 'scientificName': 'Oesophagostomum dentatum', 'fullName': 'Oesophagostomum dentatum (Nodular worm)'}"