HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "L0AXN4",
"id": "L0AXN4_THEEQ",
"source_organism": {
"taxId": "1537102",
"scientificName": "Theileria equi strain WA",
"fullName": "Theileria equi strain WA"
},
"name": "tRNA-dihydrouridine synthase",
"description": [
"Catalyzes the synthesis of dihydrouridine, a modified base found in the D-loop of most tRNAs"
],
"length": 354,
"sequence": "MENKGHFSSFWESLGNPRYVVAPMVDQSELPFRLLCRRYSAHLTYTPMLHARIFSENEKYRKTHFQTSEDDRPLIAQFCGNDPQTLVNAARIIKDDVSAIDINCGCPQGIARKGKYGAYLLDFPNVITSIVQTVTAQVDINVTCKIRLVEKESLQSTLNLCYALEASGCKALTVHGRDKTEKGVNISDCNWEAIKIIKSRVGIPGNAPSILKMSVVIANGGIESLDDVKRCLEYTGADAVMSSEAILEKPYLFTGREYNNLSIFKEYLSILKGCPEQRLSSVKSHAFKMLHKYLQVHHETREVIGRAGSIEAFDGIVQDLERVVAEDSTYSGSWYRRHRKQVTEPLLEESAPAS",
"proteome": "UP000031512",
"gene": "BEWA_031780",
"go_terms": [
{
"identifier": "GO:0017150",
"name": "tRNA dihydrouridine synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008033",
"name": "tRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "472d8faf270aff0fc25e3ad6bc9e20ee1e59630e",
"counters": {
"domain_architectures": 57766,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 57766
}
}
}