"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L0AP62"	"{'domain_architectures': 29362, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 2, 'hamap': 1, 'pirsf': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'prints': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 29362}"	"['Catalyzes the sequential NAD-dependent oxidations of L-histidinol to L-histidinaldehyde and then to L-histidine']"	"hisD"	"[{'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016616', 'name': 'oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051287', 'name': 'NAD binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004399', 'name': 'histidinol dehydrogenase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000105', 'name': 'L-histidine biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"L0AP62_NATGS"	"74c29885d030723b3b179c70eea1bde480f9dc66"	True	False	False	426	"Histidinol dehydrogenase"	3	"UP000010468"	"MSVDLEEIQELGPVDRTAFFERDAGIEAIRGDVSEIVDRVREEGDVAVREFTSEFDGVEVGNLEITDECERAYDELEGDVREAIETAAANVREFHEAQVPADWRETFDEGRELGRRFRPLERVGVYVPGGSAAYPSSAIMGVVPAVVAGVEHVTVVTPPAEELNPVTLAAIHVAGADAVYSVGGAQAIAALAYGTETVTRVQKIVGPGNRWVTAAKAEVQGDVEIDMLAGPSEVVVVADETADPELVASELVAQAEHDPNASVVAVTDDEATAKAVVEAVDEQASARERKEIIREALENDASGVLLARSMSEAILFTEEYAPEHLSIIADDDERVLERIDSAGSVFLGPNTPVAAGDYASGTNHVLPTNASARVTGGLSVETFVRSSTVQRLSGEGLAEISETITTLAEAEGLEAHAESVRKRLDR"	"unreviewed"	"{'taxId': '797304', 'scientificName': 'Natronobacterium gregoryi (strain ATCC 43098 / DSM 3393 / CCM 3738 / CIP 104747 / IAM 13177 / JCM 8860 / NBRC 102187 / NCIMB 2189 / SP2)', 'fullName': 'Natronobacterium gregoryi (strain ATCC 43098 / DSM 3393 / CCM 3738 / CIP 104747 / IAM 13177 / JCM 8860 / NBRC 102187 / NCIMB 2189 / SP2)'}"