"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"L0ACL8"	"{'domain_architectures': 35879, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 35879}"	"['Binds to the 23S rRNA']"	"rpl15"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015934', 'name': 'large ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"L0ACL8_CALLD"	"b5b396362d2e35a929b8dd30f95a3181a71943f3"	True	False	False	155	"Large ribosomal subunit protein uL15"	3	"UP000010469"	"MALTSRSRKKSRKLRGRTRSMGWGRVGQHRKSGSKGGTGGSGMNKHRKTWMLKYYPNWFGAKGFVPIRNRLLHKKNTITLRELDQIAFKLRNTNVEGDKVVLNLNEMGYDKLVANGKIYEKVKVIVKEATKKAIERVKEAGGEVIVEKIEEEEQS"	"unreviewed"	"{'taxId': '1056495', 'scientificName': 'Caldisphaera lagunensis (strain DSM 15908 / JCM 11604 / ANMR 0165 / IC-154)', 'fullName': 'Caldisphaera lagunensis (strain DSM 15908 / JCM 11604 / ANMR 0165 / IC-154)'}"