"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K9J4R9"	"{'domain_architectures': 5126, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 5126}"	"['Component of the signal peptidase complex (SPC) which catalyzes the cleavage of N-terminal signal sequences from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum. Dispensable for SPC enzymatic activity']"	""	"[{'identifier': 'GO:0006465', 'name': 'signal peptide processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005787', 'name': 'signal peptidase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"K9J4R9_DESRO"	"c6fe7d52f41a35a0873d285c39adf6638dc7ea3a"	True	False	True	153	"Signal peptidase complex subunit 1"	2	""	"AAFALPGSVGSSSCVRDRSPDPRSRSPSPCSRTPSPRSRTPALYCPPSQPVMLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRRHPLKWLPVQDSSAEDKKPGERKIKRHAKNN"	"unreviewed"	"{'taxId': '9430', 'scientificName': 'Desmodus rotundus', 'fullName': 'Desmodus rotundus (Vampire bat)'}"