"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K9IJ67"	"{'domain_architectures': 140476, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 140476}"	"['Facilitates flavin adenine dinucleotide (FAD) translocation across the mitochondrial inner membrane into the mitochondrial matrix where it acts as a redox cofactor to assist flavoenzyme activities in fundamental metabolic processes including fatty acid beta-oxidation, amino acid and choline metabolism as well as mitochondrial electron transportation. In particular, provides FAD to DLD dehydrogenase of the glycine cleavage system, part of mitochondrial one-carbon metabolic pathway involved in neural tube closure in early embryogenesis']"	""	"[{'identifier': 'GO:0006862', 'name': 'nucleotide transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"K9IJ67_DESRO"	"e037822792ef5f5d7967370632f8bf737b916266"	True	False	False	315	"Solute carrier family 25 member 32"	2	""	"MTSQGQPAPGSSVWTAVFRHVRYENLVAGVSGGVLSNFALHPLDLVKIRFAVSDGLELRPKYKGILHCLTTIWKLDGLRGLYQGVTPNVWGAGLSWGLYFFFYNAIKSYKTEGRAERLEATEYLVSAAQAGAMTLCITNPFWVAKTRLMLQYDGVLNAPQRQYKGMFDTLWKIYKCEGVRGLYKGFVPGLFGTSHGALQFMAYELLKLKYNQHINRSPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMSYEGVLDVITKTWRKEGIGGFYKGIAPNLIRVTPACCITFVVYENVSHFLLNLREEKK"	"unreviewed"	"{'taxId': '9430', 'scientificName': 'Desmodus rotundus', 'fullName': 'Desmodus rotundus (Vampire bat)'}"
