"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K9IGA6"	"{'domain_architectures': 0, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1}"	"['Probably involved in the organization of the actin cytoskeleton by acting downstream of CDC42, inducing actin filament assembly. Alters CDC42-induced cell shape changes. In activated T-cells, may play a role in CDC42-mediated F-actin accumulation at the immunological synapse. May play a role in early contractile events in phagocytosis in macrophages']"	""	"[{'identifier': 'GO:0031267', 'name': 'small GTPase binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0035023', 'name': 'regulation of Rho protein signal transduction', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"K9IGA6_DESRO"	""	True	False	False	79	"CDC42 small effector protein 1"	2	""	"MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL"	"unreviewed"	"{'taxId': '9430', 'scientificName': 'Desmodus rotundus', 'fullName': 'Desmodus rotundus (Vampire bat)'}"