"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K8F3H4"	"{'domain_architectures': 4494, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'ssf': 1, 'hamap': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4494}"	"['RuBisCO catalyzes two reactions: the carboxylation of D-ribulose 1,5-bisphosphate, the primary event in carbon dioxide fixation, as well as the oxidative fragmentation of the pentose substrate. Both reactions occur simultaneously and in competition at the same active site. Although the small subunit is not catalytic it is essential for maximal activity']"	"RBCS"	""	"K8F3H4_9CHLO"	"322f51fb3c3504dedc16381c256895b71eb3ba3e"	True	False	False	134	"Ribulose bisphosphate carboxylase small subunit, chloroplastic"	3	"UP000198341"	"MFETFSFLPPLSDADLSKQVQYLLNNGWTPCLEFEDPAHAYTDGHGNSGLDSSINTNYYDNRYWVMWKLPMYGCNDPSEVLTEVKACVKAFPNCYVRCAGFDNIKQVQCHSFLVYRPKLSPMEGGARDVADRQI"	"unreviewed"	"{'taxId': '41875', 'scientificName': 'Bathycoccus prasinos', 'fullName': 'Bathycoccus prasinos'}"
