"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K7YZ02"	"{'domain_architectures': 65483, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 65483}"	"['Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity of complex I']"	"nad3"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"K7YZ02_9DIPT"	"e9a5b42e32de65bd6bc464b4186c01128f5abeb7"	True	False	True	117	"NADH-ubiquinone oxidoreductase chain 3"	3	""	"IYSTLILGIVIMLIATVVMLLASLLSKKAFMDREKCSPFECGFDPKSSSRLPFSLRFFLITIIFLIFDVEIALILPMILVINFSNMVMWSITSSVFIFILLIGLYHEWNQGALNWSS"	"unreviewed"	"{'taxId': '560804', 'scientificName': 'Tipula abdominalis', 'fullName': 'Tipula abdominalis'}"
