"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K7AGV8"	"{'domain_architectures': 8189, 'entries': 20, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'cdd': 1, 'pfam': 2, 'pirsf': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 8}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 8189}"	"[""Catalyzes the conversion of 3'-phosphate to a 2',3'-cyclic phosphodiester at the end of RNA. The mechanism of action of the enzyme occurs in 3 steps: (A) adenylation of the enzyme by ATP; (B) transfer of adenylate to an RNA-N3'P to produce RNA-N3'PP5'A; (C) and attack of the adjacent 2'-hydroxyl on the 3'-phosphorus in the diester linkage to produce the cyclic end product. Likely functions in some aspects of cellular RNA processing. Function plays an important role in regulating axon regeneration by inhibiting central nervous system (CNS) axon regeneration following optic nerve injury""]"	"CK820_G0020779"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006396', 'name': 'RNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003963', 'name': ""RNA-3'-phosphate cyclase activity"", 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"K7AGV8_PANTR"	"29a675c08d42af527286382323e161f240614744"	True	False	False	366	"RNA 3'-terminal phosphate cyclase"	3	""	"MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVHKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELHLKGGTNAEMAPQIDYTEMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTDRGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYVNIQPVQEPKDQAFGNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL"	"unreviewed"	"{'taxId': '9598', 'scientificName': 'Pan troglodytes', 'fullName': 'Pan troglodytes (Chimpanzee)'}"
