"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K4K9B6"	"{'domain_architectures': 51372, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 51372}"	"['NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient']"	"ndhG"	"[{'identifier': 'GO:0008137', 'name': 'NADH dehydrogenase (ubiquinone) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"K4K9B6_9ROSI"	"96cfd4c69773af29d548fde0c6c747d9cca5615a"	False	False	True	178	"NAD(P)H-quinone oxidoreductase subunit 6, chloroplastic"	3	""	"MDLPGPIHDFLLVFLGLGLILGGLGVVLLTNPIYSAFSLGLVLVCISLFYILSNSHFVAAAQLLIYVGAINVLILFAVMFMNGSEYSKDFNLWTVGNGVTSLVCTSIFLSLIIIITDTSWYGIIWTTRTNQIIEQDXLXISNSQQIGIHLSTDFFLPFEFISIILLVALIGAIAVARQ"	"unreviewed"	"{'taxId': '256092', 'scientificName': 'Bergia texana', 'fullName': 'Bergia texana'}"
