"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K1M5R8"	"{'domain_architectures': 24144, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'ncbifam': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 24144}"	"[""RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme""]"	"rnpA"	"[{'identifier': 'GO:0000049', 'name': 'tRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004526', 'name': 'ribonuclease P activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008033', 'name': 'tRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"K1M5R8_9LACO"	"c1c3f0c110430b6b6339279d367a29870e812f7d"	True	False	False	122	"Ribonuclease P protein component"	3	""	"MRKSYRVKSEKDFQQVFESGDSVANRAFVIYKVEKTENKHFRVGISVGKKVGHTAVARNRLKRYIRAVIDEEKLQINPHVDFLIITRPYARDFNMAQVRKNLLHALSLAHIIEEMPDKVEEK"	"unreviewed"	"{'taxId': '883092', 'scientificName': 'Lactobacillus crispatus FB077-07', 'fullName': 'Lactobacillus crispatus FB077-07'}"
