"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"K0X382"	"{'domain_architectures': 25972, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 25972}"	"[""One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA""]"	"rbfA"	"[{'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"K0X382_9BACT"	"02dd50e56d760f4ef70ea7b524c67a15aa942f7f"	True	False	False	111	"Ribosome-binding factor A"	3	"UP000006044"	"METTRQNKISRLLQKELSDIFLAETRKTHGIIISVSVVRVSPDLSTAKAYLSIFPPEKSAEMIENINANTKTIRYELSQRVRYQLRKTPELSFFLDDSLDYIENIDSLLKK"	"unreviewed"	"{'taxId': '742726', 'scientificName': 'Barnesiella intestinihominis YIT 11860', 'fullName': 'Barnesiella intestinihominis YIT 11860'}"
